DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and AT4G00840

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_567193.2 Gene:AT4G00840 / 826193 AraportID:AT4G00840 Length:291 Species:Arabidopsis thaliana


Alignment Length:260 Identity:68/260 - (26%)
Similarity:105/260 - (40%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LVAVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLASLF-LIFNITSNMLACMLVDTSIRKEL--- 83
            |.|:...:.::||..::|            |||  |.| .:|....:      |....|:|:   
plant    49 LSALAALIIFVFHFLLIM------------LLW--SYFTTVFTDPGS------VPEHFRREMGGG 93

  Fly    84 ----LKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFY 144
                .....|.........|..|:.:.|||..||.||..||||.||||.:...|:|..||::|..
plant    94 DSLEAGTSTDQGAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLL 158

  Fly   145 YLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGF 209
            :|.|..:.::              ||:.....:....|:..:....||...:..::.:   :|.|
plant   159 FLFYTFLETM--------------LDVIVLLPSFIEFFSQAIKHSSSPGKLASLVLAF---VLNF 206

  Fly   210 A-ISSLL--LVFHWSIFKSGSVTRERGTR------KYDRGLRGNLEMVLGKRMHLTWLSPFLRSD 265
            | :.|||  :|.|.|:..|.:.:.|...:      |||.|.:.|.|.|.||:... ||.|....|
plant   207 AFVLSLLCFVVMHISLLSSNTTSVEVHEKNGEVRWKYDLGKKKNFEQVFGKKKAF-WLLPLYSKD 270

  Fly   266  265
            plant   271  270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 39/135 (29%)
AT4G00840NP_567193.2 zf-DHHC 4..266 CDD:303066 66/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.