DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and AT3G18620

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_188492.2 Gene:AT3G18620 / 821393 AraportID:AT3G18620 Length:345 Species:Arabidopsis thaliana


Alignment Length:232 Identity:62/232 - (26%)
Similarity:96/232 - (41%) Gaps:61/232 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CFLLV-AVFVPVTYIFHVTIVMPELFAI-GGIW--YTLLWLASLF--LIFNITSNMLACMLVDTS 78
            ||::: |||:              ||.| ||||  |.:|:..||.  :..::|:..||...:.|.
plant    67 CFVVILAVFM--------------LFVICGGIWAAYPVLFSISLACGIFHSVTTATLAISTLSTF 117

  Fly    79 IRKEL------------LKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTC 131
            |....            ..|.:....|..:..|..|.....||:.||..|.:|||..||||.|..
plant   118 ILVAFKCAGKPTNILYGTHPGVGNGALNNYTFCNYCSKPKSPRTHHCRTCGMCVLDMDHHCPFIG 182

  Fly   132 CCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPV---------VS 187
            .|:|..|::||..:|:..:|.:..||:| .:|             ||..|..|:         |:
plant   183 NCVGAGNHKYFIAFLISAVISTSYAAVM-CVY-------------TLIHILPPIEKGAAYASDVA 233

  Fly   188 LMLSPSWESFYLVIYDLTLLGFA------ISSLLLVF 218
            .:...:..|...|:.::.|...|      :.||:||:
plant   234 HVAHGNSISILRVVKNICLTYIANAVFISVRSLVLVY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 39/135 (29%)
AT3G18620NP_188492.2 DHHC 76..>219 CDD:418707 46/170 (27%)
DHHC 149..298 CDD:396215 39/136 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D863846at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.