Sequence 1: | NP_610853.1 | Gene: | CG4676 / 36465 | FlyBaseID: | FBgn0033815 | Length: | 284 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016865358.1 | Gene: | ZDHHC11 / 79844 | HGNCID: | 19158 | Length: | 559 | Species: | Homo sapiens |
Alignment Length: | 300 | Identity: | 63/300 - (21%) |
---|---|---|---|
Similarity: | 100/300 - (33%) | Gaps: | 133/300 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 VFVPV-----TYIFHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNMLACML--VDTSIRKEL 83
Fly 84 LK------PPLDAAQLAR---------------------WHSCQDCQT-----LVPPR------- 109
Fly 110 -------------------------SWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFF------ 143
Fly 144 ------------YYLVYMII--GSLAA----AIMESIYLWHLHLDIY-WRWSTLFTIFAPVVSLM 189
Fly 190 LSPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVT 229 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4676 | NP_610853.1 | zf-DHHC | 99..232 | CDD:279823 | 43/192 (22%) |
ZDHHC11 | XP_016865358.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |