DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc20

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006519721.1 Gene:Zdhhc20 / 75965 MGIID:1923215 Length:475 Species:Mus musculus


Alignment Length:300 Identity:68/300 - (22%)
Similarity:115/300 - (38%) Gaps:63/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CFLLVAVFVPVTYI----------FHVTIVMPELFAIGGIWYTLLWLAS--LFLIFNITSNMLAC 72
            |...|..:|||.:|          :.|.:.:..:...|....|:::|.:  ||.:..:.|..:..
Mouse   104 CCQRVVGWVPVLFITFVVVWSYYAYVVELCVSTISRTGEKGKTVVYLVAFHLFFVMFVWSYWMTI 168

  Fly    73 MLVDTSIRKE-----------------------LLKPPLD-------AAQLARWHSCQDCQTLVP 107
            .....|..||                       |.:...|       |::..|:  |:.||.:.|
Mouse   169 FTSPASPSKEFYLSNSEKERYEKEFSQERQQDILRRAARDLPIYTTSASKAIRY--CEKCQLIKP 231

  Fly   108 PRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSL--AAAIME-SIYLWHLHL 169
            .|:.||..|:.||||.||||.:...|:|..||::|..:|:|.::..|  ||.::| .|..|.|  
Mouse   232 DRAHHCSACDRCVLKMDHHCPWVNNCVGFTNYKFFMLFLLYSLLYCLFVAATVLEYFIKFWTL-- 294

  Fly   170 DIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFH-WSIFKSGSVTRERG 233
               .|..:.........:::..||.:...|.::.::.:.|.....|..:| |.:.|:.:......
Mouse   295 ---CRRKSTENCPKNEPTVLNFPSAKFHVLFLFFVSAMFFVSVLSLFSYHCWLVGKNRTTIESFR 356

  Fly   234 TRKYDRGLRG---------NLEMVLGKRMHLTWLSPFLRS 264
            ...:..|:.|         |...|.|..... ||.|...|
Mouse   357 APMFSYGIDGNGFSLGCSKNWRQVFGDEKKY-WLVPIFSS 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 39/136 (29%)
Zdhhc20XP_006519721.1 DHHC 111..411 CDD:388695 65/292 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.