DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc11

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_081980.1 Gene:Zdhhc11 / 71164 MGIID:1918414 Length:347 Species:Mus musculus


Alignment Length:314 Identity:78/314 - (24%)
Similarity:130/314 - (41%) Gaps:68/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SWDRVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNML 70
            ||......||..|..|:   .|:|.::.:...|||      ||::           ||::..:::
Mouse    48 SWITYLAMSIVTFGIFI---PFLPYSWKYAANIVM------GGVF-----------IFHLIVHLI 92

  Fly    71 ACML--VDTSIR-KELLKPPLDAAQLARWHS-------CQDCQTLVPPRSWHCEVCNVCVLKRDH 125
            |..:  .||::| |:....|:.|...:: |:       |..|:.....::.||..||.||...||
Mouse    93 AITIDPADTNVRLKKDYTQPVPAFDRSK-HTHVIQNQYCHLCEVTASKKAKHCSACNKCVSGFDH 156

  Fly   126 HCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFT--IFAPVVS- 187
            ||::...|:|..||.:||:.:....:|.|...|:    |.::.:..:.....|.|  ::..::| 
Mouse   157 HCKWLNNCVGRRNYWFFFWSVASAAVGILGVMII----LCYICIQYFVNPDELRTDPLYKEIISE 217

  Fly   188 ----LMLS----PSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKY--DRGLR 242
                |.||    |......|.|..:.|| .||:|.:::.|..||....:|:...|..|  ....:
Mouse   218 NTWLLFLSLWPVPVKTPIVLSIAVMALL-LAIASFVMLGHLLIFHLYLITKNMSTFDYLMKTRFK 281

  Fly   243 GNLEMVLGKRMHLTWLSPFLRSDLPHD-GMNWE-------------PIAAFSPK 282
            .||.....|.:.|.     .:.|||.: ..||.             |::..|||
Mouse   282 KNLHPAEEKELPLQ-----KKGDLPQEKSDNWAWPKSPPRVGSQKFPVSTLSPK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 40/143 (28%)
Zdhhc11NP_081980.1 zf-DHHC 123..277 CDD:279823 42/158 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..332 10/45 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.