DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_081582.1 Gene:Zdhhc25 / 70073 MGIID:1917323 Length:279 Species:Mus musculus


Alignment Length:217 Identity:56/217 - (25%)
Similarity:98/217 - (45%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LFLIFN-ITSNMLACMLVDTSIRKELLKP---PL------DAAQLARWHSCQDCQTLVPPRSWHC 113
            |:::.| :..::||.:.:.:.:|..|..|   ||      |....     |.||.:.:|..:.||
Mouse    66 LYIVANGVVFHLLASLALASHLRTMLTDPGSVPLGNPPGPDTVSY-----CTDCHSAIPRTACHC 125

  Fly   114 EVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTL 178
            .||..|:.|.||||.:...|||..|.:||..:.:|:.:.|....::..|.:...::...|..|:.
Mouse   126 TVCQRCIRKNDHHCPWINNCIGEDNQKYFLLFTMYIGLTSTHVLLLLGIPVLCSYMRGEWDSSST 190

  Fly   179 FTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDRGLR- 242
            .::.||::.|:|             :.::||..:.::|.....:..|...|.|...:....|.| 
Mouse   191 VSLPAPILFLLL-------------VAIMGFLFAVVMLCSQMCVIYSDKTTTELLYQNTHSGGRW 242

  Fly   243 ---GNLEMVLGKRMHLTWLSPF 261
               .|::.|.|..:.|.|||||
Mouse   243 SKCANMKAVCGSHVSLAWLSPF 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 34/132 (26%)
Zdhhc25NP_081582.1 zf-DHHC 109..230 CDD:279823 34/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.