DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc12

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_079704.2 Gene:Zdhhc12 / 66220 MGIID:1913470 Length:281 Species:Mus musculus


Alignment Length:260 Identity:72/260 - (27%)
Similarity:101/260 - (38%) Gaps:75/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YTLLWLASLFLIFNITSNMLACMLVD----TSIRKELLKPPLDAA----QLARWHSCQDCQTLVP 107
            :.||.|:||.|       .||..|:|    |:..:...:|..:.|    |......|:.|..|.|
Mouse    64 FLLLVLSSLLL-------YLAVSLMDPGYVTTQPQPQGEPKEEQAAMVPQAVPLRRCRHCLVLQP 121

  Fly   108 PRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHL----- 167
            .|:.||..|..||.:.||||.:...|:|..|:..|..||...::          :.||.|     
Mouse   122 LRARHCRDCRRCVRRYDHHCPWMENCVGERNHPLFVAYLALQLV----------VLLWGLCLAWS 176

  Fly   168 HLDIYWRW-----ST--LFT------IFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFH 219
            .|..:..|     ||  |||      .||.||:|:|:   ...|||..:.|...| |||..:.: 
Mouse   177 GLQFFQPWGLWLRSTGLLFTTFLLLSFFALVVALLLA---SHLYLVARNTTTWEF-ISSHRIAY- 236

  Fly   220 WSIFKSGSVTRERGTRKYDRGLRGNLEMVLGKRMHLTWLS-PFLRSDLPHDGMNWEPIAAFSPKE 283
                     .|:|.:..:|||...||     ......|.| |            ||.::|...:|
Mouse   237 ---------LRQRTSNPFDRGPTRNL-----AHFFCGWPSGP------------WETLSAEEEEE 275

  Fly   284  283
            Mouse   276  275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 45/150 (30%)
Zdhhc12NP_079704.2 zf-DHHC <137..231 CDD:279823 32/107 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.