DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc16

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006231465.1 Gene:Zdhhc16 / 654495 RGDID:1591893 Length:377 Species:Rattus norvegicus


Alignment Length:316 Identity:79/316 - (25%)
Similarity:118/316 - (37%) Gaps:80/316 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AVFVPVTYI-------FHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNMLAC---------- 72
            |.|.||.::       |.|..|:..:...|.| ..:.:|..|.||....|....|          
  Rat    63 AAFEPVYWLVDNVIRWFGVVFVVLVIVLTGSI-VAIAYLCVLPLILRTYSVPRLCWHFFYSHWNL 126

  Fly    73 MLVDTSIRKELLKPPLDAAQ----LARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCC 133
            :|:.....:.:..||....|    :|....|:.|....|.|:.||.:||.||||.||||.:...|
  Rat   127 ILIVFHYYQAITTPPGYPPQGRNDIATVSICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNC 191

  Fly   134 IGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSL---------- 188
            :||:|:||||.:..:|.:|.:..:              |..|......:|.:..:          
  Rat   192 VGHYNHRYFFSFCFFMTLGCVYCS--------------YGSWDLFREAYAAIEKMKQLDKNKLQA 242

  Fly   189 -------MLSPSWESF--YLVIYDLTLLGFAISSL------LLVFHWSIFKSGSVTRERGTRK-- 236
                   ...|...||  .:....|..|.|..||:      |.::|..:...|..:.||...|  
  Rat   243 IANQTYHQTPPPTFSFRERITHKSLVYLWFLCSSVALALGALTMWHAVLISRGETSIERHINKKE 307

  Fly   237 --------------YDRGLRGNLEMVLGKRMHLTWLSPFL--RSDLPH-DGMNWEP 275
                          |:.|...|.::.||......||:..|  .|.||| :||:|:|
  Rat   308 RRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWDP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 40/157 (25%)
Zdhhc16XP_006231465.1 DHHC 156..305 CDD:396215 42/162 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.