DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and zdhhc14

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001038652.1 Gene:zdhhc14 / 569667 ZFINID:ZDB-GENE-040724-21 Length:513 Species:Danio rerio


Alignment Length:274 Identity:59/274 - (21%)
Similarity:110/274 - (40%) Gaps:76/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TYIFHVTIVM---------------------PELFAIGGIWYTLLWLASLFLIFNITSNMLACML 74
            |.:|::|:|:                     |.:.||||:         ||:.  :...:|....
Zfish    60 TGVFYLTMVLILVTSGLFFAFDCPFLASNLTPAIPAIGGV---------LFVF--VMGMLLRASF 113

  Fly    75 VD------------TSIRKEL----------LKPP------LDAAQLARWHSCQDCQTLVPPRSW 111
            .|            ..|.:::          .:||      |...|..:...|..|:...|||:.
Zfish   114 SDPGVLPRATPEEAADIERQIDANNGPSGPGYRPPPRTREVLINGQTVKLKYCFTCKIFRPPRAS 178

  Fly   112 HCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWS 176
            ||.:|:.||.:.||||.:...|:|..|||:|:.:::.:   |.....:.:..:.|:.|:...:..
Zfish   179 HCSLCDNCVDRFDHHCPWVGNCVGRRNYRFFYLFILSL---SFLTIFIFAFVITHVILNALRKAL 240

  Fly   177 TLFTIFAPVVSLMLSPSWESFYLV-------IYDLTLLGFAISSL--LLVFHWSIFKSGSVTRE- 231
            .|.|. |...::...|:..:|.::       :.::.:..|::.|:  |..||..:..|...|.| 
Zfish   241 ALSTA-ADFEAVQKDPTGLAFLVLSKTALLDVLEVVVCFFSVWSIVGLSGFHTYLISSNQTTNED 304

  Fly   232 -RGTRKYDRGLRGN 244
             :|:....|| :||
Zfish   305 IKGSWSSKRG-KGN 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 36/143 (25%)
zdhhc14NP_001038652.1 zf-DHHC 163..306 CDD:279823 36/146 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.