DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and zdhhc12b

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_021327289.1 Gene:zdhhc12b / 569129 ZFINID:ZDB-GENE-070705-356 Length:270 Species:Danio rerio


Alignment Length:274 Identity:63/274 - (22%)
Similarity:96/274 - (35%) Gaps:86/274 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FLLVAVFVPVTYI------FHVT----------IVMPELFAIGGIWYTLLWLASLFLIFNITSNM 69
            ||:....|.:|::      .|.|          :.:|.||       .||.|.|:.|.|.::...
Zfish    10 FLVRTAHVILTWVITLILFLHDTDLRRQEETGELTLPVLF-------VLLVLVSVLLYFAVSLMD 67

  Fly    70 LACMLVD-------TSIRKELLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHC 127
            ...:|.|       ..|.:|.........:..|...|..|....|.||.||:.|..||.:.||||
Zfish    68 PGFVLTDDCDLQFTLGIAEETQDMIPQTTKSIRLRRCGHCLVQQPMRSKHCQTCQHCVRRYDHHC 132

  Fly   128 RFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSP 192
            .:...|:|..|:|:|..||...::          :.||.|    |..||          ....:.
Zfish   133 PWIENCVGERNHRWFVLYLAVQLV----------VLLWGL----YMAWS----------GFSHAS 173

  Fly   193 SWESF------------YLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTR---------- 235
            :|:.:            .:.|..||:|      |||..|..:....:.|.|..:|          
Zfish   174 TWQQWLRTNGVLLGAAAVVAILALTVL------LLLGSHLYLVSLNTTTWEFMSRHRISYLKHCG 232

  Fly   236 ----KYDRGLRGNL 245
                .:|:|:..||
Zfish   233 ADENPFDKGILRNL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 37/144 (26%)
zdhhc12bXP_021327289.1 zf-DHHC 97..>171 CDD:307600 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.