DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and zdhhc1

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_691086.3 Gene:zdhhc1 / 562614 ZFINID:ZDB-GENE-130925-1 Length:578 Species:Danio rerio


Alignment Length:246 Identity:58/246 - (23%)
Similarity:94/246 - (38%) Gaps:46/246 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SWDRVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNML 70
            ||    |.....|..:||...|....:...|.::.......|.|...:.::..||:      :::
Zfish    34 SW----PPHPFQFLAWLLYLYFAVTGFGVFVPLLPTHWIPAGYICTGITFVCHLFM------HLM 88

  Fly    71 ACML--VDTSIRKELLKPPLDAAQLARWHS-------CQDCQTLVPPRSWHCEVCNVCVLKRDHH 126
            |..:  .|.::|.:..|.|:......: |:       |..|:..|.|:|.||..||.||...|||
Zfish    89 AVSIDPADYNVRAKSYKGPMPVFDRTK-HAHVIENCHCYLCEVDVGPKSKHCSACNKCVASFDHH 152

  Fly   127 CRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLD-----------------IYWR 174
            ||:...|:|..||..|...::..::|.:...::.|.......||                 :.| 
Zfish   153 CRWLNNCVGSRNYWLFLNSVISALLGIVLVVVIASYVFIEFFLDPSKLRSDKHFQQVRNESVVW- 216

  Fly   175 WSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFH----WS 221
              .:|...|||.:  ..|:..:...|...|.||...:...||.||    |:
Zfish   217 --FVFLPVAPVTT--AGPAIPALAGVTIALGLLSALLLGHLLCFHIYLMWN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 40/144 (28%)
zdhhc1XP_691086.3 DHHC 118..274 CDD:396215 40/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.