Sequence 1: | NP_610853.1 | Gene: | CG4676 / 36465 | FlyBaseID: | FBgn0033815 | Length: | 284 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011542846.1 | Gene: | ZDHHC2 / 51201 | HGNCID: | 18469 | Length: | 412 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 58/198 - (29%) |
---|---|---|---|
Similarity: | 82/198 - (41%) | Gaps: | 33/198 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 CQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIY 163
Fly 164 ---LWHLHL-DIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAI------SSLLLVF 218
Fly 219 HWSIFKSGSVTRERGTRKYDRGLRGNLEMVLGKRMHLTWLSPFLRS-----DLPHDGMNWEPIAA 278
Fly 279 FSP 281 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4676 | NP_610853.1 | zf-DHHC | 99..232 | CDD:279823 | 44/142 (31%) |
ZDHHC2 | XP_011542846.1 | zf-DHHC | 172..293 | CDD:279823 | 41/130 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |