DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006539081.1 Gene:Zdhhc18 / 503610 MGIID:3527792 Length:407 Species:Mus musculus


Alignment Length:262 Identity:62/262 - (23%)
Similarity:105/262 - (40%) Gaps:72/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FACFLLVAVFVPVTYIFHV----------TIVMPELFAIGGIWYTLLWLASLFLIFNITSNMLAC 72
            ||..||  :.:..|.:|.|          |:.:|.:.||              |.|.:.|.:|..
Mouse    86 FALTLL--LILSTTILFFVFDCPYLARTLTLAIPIIAAI--------------LFFFVMSCLLQT 134

  Fly    73 MLVD------------TSIRKEL-------LKPP------LDAAQLARWHSCQDCQTLVPPRSWH 112
            ...|            .::.|::       .:||      :...|..:...|..|:...|||:.|
Mouse   135 SFTDPGILPRATICEAAALEKQIDNTGSSTYRPPPRTREVMINGQTVKLKYCFTCKMFRPPRTSH 199

  Fly   113 CEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWST 177
            |.||:.||.:.||||.:...|:|..|||:|:.::  :.:..|.|.|...:.   .||.:..:.|.
Mouse   200 CSVCDNCVERFDHHCPWVGNCVGRRNYRFFYAFI--LSLSFLTAFIFACVV---THLTLLSQGSN 259

  Fly   178 LFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLV--FHWSIFKSGSVTRE--RGTRKYD 238
            ..:      :|..:|:      .:.:|.:..|:|.|:|.:  ||..:..|...|.|  :|:....
Mouse   260 FLS------ALKKTPA------SVLELVICFFSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSK 312

  Fly   239 RG 240
            ||
Mouse   313 RG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 39/136 (29%)
Zdhhc18XP_006539081.1 DHHC 183..306 CDD:366691 39/139 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.