DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and zdhhc15a

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001006003.1 Gene:zdhhc15a / 449833 ZFINID:ZDB-GENE-041010-87 Length:328 Species:Danio rerio


Alignment Length:285 Identity:72/285 - (25%)
Similarity:118/285 - (41%) Gaps:78/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CFLLVA------VFVPVTYIFHVTIVMPELFAIGGIWYTLLWLA--------SLFLIFNITSNML 70
            |::|::      ||:   .:||:..         |::....|.|        |:...|:.:.::|
Zfish    38 CWILLSSAIQRVVFL---CLFHLCF---------GMFSWSFWKAVSTPPSSPSVEFQFSTSDSLL 90

  Fly    71 ACMLVDTSIRKELLKPPLDAAQLARWHS---------CQDCQTLVPPRSWHCEVCNVCVLKRDHH 126
            ..:..|...:..:|   |:.:|....|:         |..||.:.|.|..||.||..||||.|||
Zfish    91 YELERDDVEKSPIL---LEISQKLPVHTRTATGAIRFCHHCQLIKPDRCHHCSVCQTCVLKMDHH 152

  Fly   127 CRFTCCCIGHHNYRYFFYYLVY------MIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPV 185
            |.:...|:|..||::|..:|:|      :|:.::...:   |.||...|  :.....|..:|..:
Zfish   153 CLWLNNCMGFSNYKFFMLFLLYSLLYCLLIVSTVTPTV---IQLWRGRL--FDSCVELHVLFLTL 212

  Fly   186 VSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRE----------RGTRKYDRG 240
            ||            .|:.:||      ..||:||..:..|...|.|          .|::.:|.|
Zfish   213 VS------------AIFAITL------CFLLIFHIWLLTSNKTTLEWLSVPFFVNGPGSKAFDVG 259

  Fly   241 LRGNLEMVLGKRMHLTWLSPFLRSD 265
            ::.|...|.||:..| ||.|...|:
Zfish   260 VQANFLQVFGKKKRL-WLFPVFSSE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 43/148 (29%)
zdhhc15aNP_001006003.1 DHHC 123..243 CDD:366691 43/142 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.