DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and CG5880

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster


Alignment Length:290 Identity:67/290 - (23%)
Similarity:110/290 - (37%) Gaps:72/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FLLVAVFVPVTYIFHVT--IVMPELFAIGGIWYTLLWLASLFLIFNITSNMLACMLVDTSIRKEL 83
            |.:|.|....|.:..:.  |.:|       .|:....|.:.||:  |..|.|...:|...:...:
  Fly    65 FFVVGVAALTTSVVSIAYWIGLP-------FWWAKSQLVTYFLL--IVGNWLLLNVVFHYVMAVI 120

  Fly    84 L---KPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYY 145
            .   .||...:.:.....|..|....|||:.||.:||.|:||.||||.:...|:|:.|:||||.|
  Fly   121 TPAGHPPEGVSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLY 185

  Fly   146 LVYMIIGSLAAAI----MESIYLWHLHLDIYWRWSTL---------FTIFAPVV---------SL 188
            :.|..:|.|...:    :...|||   ||....|:.:         |.:...::         ..
  Fly   186 MTYTTLGCLFLILFGLEIGHKYLW---LDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEF 247

  Fly   189 MLSPSWESFYLVIYD-----------LTLLGFAISSLLL------VFHWSIFKSGSVTRE----R 232
            :|.|:..:....|.|           |..:.|...:::|      ::|..:...|..:.|    .
  Fly   248 VLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAHINE 312

  Fly   233 GTRK------------YDRGLRGNLEMVLG 250
            ..||            |:.|.:.|.::.||
  Fly   313 AERKRHLQQQRIYINPYNFGTKKNWKLFLG 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 44/175 (25%)
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.