DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and CG4956

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster


Alignment Length:276 Identity:92/276 - (33%)
Similarity:135/276 - (48%) Gaps:24/276 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSN-MLAC 72
            |:|...:....|.:.:...:.:.:::.:..|:|::....|||:.|.|...::.:.||..| .|.|
  Fly    34 RIKVMGLLHPFCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGC 98

  Fly    73 MLVDTSIRKELLK---PPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCI 134
            | .:||:...:|:   |....|.|  ||.|..||.|||||||||.:||:|:|||||||.|...||
  Fly    99 M-TNTSVDSLVLERQYPVAGEAHL--WHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCI 160

  Fly   135 GHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPS------ 193
            ||.|.|||..:|.::..||..|.:...|..|         .:..|.:..|:: ||...:      
  Fly   161 GHKNQRYFLAFLFHLSFGSGQALVYNGILNW---------TNKAFLVVDPLL-LMFQDTTQDADF 215

  Fly   194 -WESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDRGLRGNLEMVLGKRMHLTW 257
             |:.....::.|.|..|.:...:.||...:....|...:...|.||.|.|.|.:||||||....:
  Fly   216 KWKYTIANLFKLNLFLFGVPLFMFVFQMIMVYRNSTCYKMLDRSYDVGWRRNFDMVLGKRRFWIF 280

  Fly   258 LSPFLRSDLPHDGMNW 273
            .||.:.|.||.||..|
  Fly   281 FSPTISSPLPTDGTQW 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 48/139 (35%)
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 48/137 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469546
Domainoid 1 1.000 74 1.000 Domainoid score I9123
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4533
Isobase 1 0.950 - 0 Normalized mean entropy S3153
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
1110.850

Return to query results.
Submit another query.