DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and CG17197

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:271 Identity:97/271 - (35%)
Similarity:152/271 - (56%) Gaps:31/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VFVPVTYIFHVTI----VMPELFAIGGIWYTLLWLASLFLIFNITSNMLACMLVDTSIR-----K 81
            :||.||.||.|.:    |:|:||.:.|..|.|.||.::|:.:||..|||||.:..||:.     :
  Fly    29 LFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITSTSVESLPKDR 93

  Fly    82 ELLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYL 146
            ::.:|    .:..:||.|..|:.|:|||||||.:|..|:||||.||.||..|:||:|.||||::.
  Fly    94 QIPEP----EEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFT 154

  Fly   147 VYMIIG---SLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLG 208
            ::|.:|   :||..|:.::.        |:.:|.|  ||..:....|.|.|....|:: :..:..
  Fly   155 LFMALGTGVALATHIIATLK--------YFSYSDL--IFLNIPRDNLPPFWLVITLIL-NTYVFA 208

  Fly   209 FAISSLLLVFHWSIFKSGSVTRERGTRKYDRGLRGNLEMVLGKRMHLTWLSPFLRSDLPHDGMNW 273
            ..:||:|:  ..|:.|:.....:..:..||.||..|.:::||.:...|:|||.::|.|||||..|
  Fly   209 APVSSVLM--QLSVLKNNGTLHKFYSDTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDGAQW 271

  Fly   274 --EPIAAFSPK 282
              :.:...|||
  Fly   272 KIKRVQHHSPK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 47/135 (35%)
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 17/40 (43%)
zf-DHHC 100..>198 CDD:279823 43/107 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469544
Domainoid 1 1.000 74 1.000 Domainoid score I9123
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4533
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
98.890

Return to query results.
Submit another query.