DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and CG5196

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:300 Identity:76/300 - (25%)
Similarity:115/300 - (38%) Gaps:74/300 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWY----TLLWLA--SLFLIFN--ITSNMLA 71
            ||.|..||   .:.|:|.:..:..:......:..:|:    :....|  :|||:.:  .|.|.:.
  Fly     5 ISGFRRFL---HWGPITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQALFLLLSTLATFNYVM 66

  Fly    72 CMLVDTSIRKELLKP--PLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCI 134
            ..|....:..:...|  |.||..|   ..|:.|:....|||.||..|:.||.|.||||.:...|:
  Fly    67 ATLTGPGLMPKQWHPKDPKDAQFL---QYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCV 128

  Fly   135 GHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYL 199
            |..|:.||.|:|::.|:|||...::.....|.   .|| |:..|....|.:.|:       .|.|
  Fly   129 GWANHAYFTYFLLFSILGSLQGTVVLCCSFWR---GIY-RYYYLTHGLAHLASV-------QFTL 182

  Fly   200 VIYDLTLLGFAIS-------SLLLVFH-------------WSIFKSGSVTRERGT-------RKY 237
            :...:.:||..::       |:||...             | |.:.....|.|..       ..|
  Fly   183 LSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIW-IVEKAIYRRYRNADCDDEFLYPY 246

  Fly   238 DRGLRGNLEMVLG----KRMHLTWLSPFLRSDLPHDGMNW 273
            |.|.|.||.:|..    ||               .||:.|
  Fly   247 DLGWRANLRLVFNDECQKR---------------GDGIEW 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 43/152 (28%)
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 41/147 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467510
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.