DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and app

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster


Alignment Length:294 Identity:72/294 - (24%)
Similarity:116/294 - (39%) Gaps:72/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILRSWDRVKPRSISDFACFLLVAVFVPVTYIFHVTIVM---------------------PELFAI 46
            :.|.|:....|  :.|.|..|: :..|.|.:|::|.::                     |.:..:
  Fly    18 VTRKWELFAGR--NKFYCDGLL-MSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINPAIPIV 79

  Fly    47 GGIWYTLLWLASLFLIFN------ITSNMLACML-----VDTSIRKELLKPP------LDAAQLA 94
            |.:.|.....:.|...|.      ..||..|..:     |..|:.....:||      |...|..
  Fly    80 GAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTV 144

  Fly    95 RWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLA--AA 157
            :...|..|:...|||:.||.:|:.||.:.||||.:...|:|..|||:|:.:||     |||  |.
  Fly   145 KLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLV-----SLAFLAV 204

  Fly   158 IMESIYLWHLHLDIYWRWSTLFTIF--APVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFHW 220
            .:.|..:.||.| :..:...:|.:.  ||...:::...:.|.:.||      |.|      .||.
  Fly   205 FIFSCSVTHLVL-LMKKEHEVFNVIKAAPFTVIVVFICFFSIWSVI------GLA------GFHT 256

  Fly   221 SIFKS---------GSVTRERGTRKYDRGLRGNL 245
            .:..|         ||.:.:.|.|..:...|||:
  Fly   257 YLTTSDQTTNEDLKGSFSSKGGPRTQNPYSRGNI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 43/145 (30%)
appNP_648561.2 zf-DHHC 146..270 CDD:279823 41/141 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467547
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.