DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and CG17287

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster


Alignment Length:333 Identity:65/333 - (19%)
Similarity:114/333 - (34%) Gaps:134/333 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RSISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLASLFL---------------- 61
            :.:||:....|:..|      :|:.     ||.....|:..:::|.:.:                
  Fly    42 KKVSDYLTIGLLLFF------YHLL-----LFMFLWTWFRCIFVAPVRIPDQWKISPEDVDKLKR 95

  Fly    62 ---------IFNITSNML--ACMLVDTSIRKELLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEV 115
                     :.|..:..|  |...:|..:|                 .|:.|..:.|.|:.||..
  Fly    96 NDGIEGASRVLNYAARNLPIATCTIDGLVR-----------------YCKTCWIIKPDRAHHCRT 143

  Fly   116 CNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFT 180
            |::||||.||||.:...|:..||::||..:|.|           ..:|.::|             
  Fly   144 CHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFY-----------AEVYCFYL------------- 184

  Fly   181 IFAPVVSLMLSPSWESFYLVIYDLTLL-GFAISSLLLVFHWSIFK------------------SG 226
                            |.:::|||.|: ||.:::|.....|:|.:                  ..
  Fly   185 ----------------FCVMVYDLYLICGFEVTALKNQHSWNILQYLVCILFNIFTVIMYTVSLL 233

  Fly   227 SVTRERGTRK----------------YDRGLRGNLEMVLGKRMHLTWLSPFLRSDLPHDGMNWEP 275
            :|:|.|.|.:                ::.|...|...:.|.:.:| |..|...|  ..||.:: |
  Fly   234 NVSRNRTTMESAYATYFLLGGKNNNGFNLGYFVNFRDLYGDKWYL-WPFPIFSS--RGDGFSF-P 294

  Fly   276 IAAFSPKE 283
            :|....||
  Fly   295 LAHDRLKE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 36/151 (24%)
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 39/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467490
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.