DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001032741.1 Gene:Zdhhc6 / 361771 RGDID:1304657 Length:413 Species:Rattus norvegicus


Alignment Length:278 Identity:70/278 - (25%)
Similarity:103/278 - (37%) Gaps:80/278 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IWYTLLW-------LASLFLIFN----ITSNMLACMLVDTSIRKELLKP--PLDAAQLARWHSCQ 100
            :||   |       ..:..::.|    |..|....|...........||  |.|:..|   ..|:
  Rat    44 LWY---WPLHTTGGSVNFIMLINWTVMILYNYFNAMFAGPGFVPRGWKPENPQDSMYL---QYCK 102

  Fly   101 DCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLW 165
            .||....|||.||..||.||:|.||||.:...|.||.|:..|..:|:...:|...||.   |::.
  Rat   103 VCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHQNHASFTLFLLLAPLGCTHAAF---IFVM 164

  Fly   166 HLHLDIYWR----WSTLFTIFAPVVSLMLS------PSWESFYLVIYDLTL--LGFAISSLLLVF 218
            .::..:|.|    |:|        |.:.:|      |....|.|..:..||  ||.|:.:.:.|.
  Rat   165 TMYTQLYNRLSFGWNT--------VKIDMSAARRDPPPIVPFGLAAFAATLFALGLALGTTIAVG 221

  Fly   219 HWSIFKSGSVTRERGTRK-----------------------YDRGLR-GNLEMVLGKRMHLTWLS 259
            .....:...:.|.:.:.:                       ||.|.: .||:.|      .||  
  Rat   222 MLFFIQIKIILRNKTSIESWIEEKAKDRIQYYQLDEVFVFPYDMGSKWKNLKQV------FTW-- 278

  Fly   260 PFLRSDLPH-DGMNWEPI 276
                |.:|. ||:.| ||
  Rat   279 ----SGVPEGDGLEW-PI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 43/144 (30%)
Zdhhc6NP_001032741.1 DHHC 95..241 CDD:396215 44/159 (28%)
SH3_2 317..394 CDD:400139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.