DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and CG1407

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster


Alignment Length:308 Identity:71/308 - (23%)
Similarity:110/308 - (35%) Gaps:81/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CFLLVAVFVPVTYIFHVTIVMPELFA-------------IGGIWYTLLWLASLFLIFNITSNMLA 71
            |...:|||..:..:|...::....:|             ||.|:..|.:  .|||...:.|....
  Fly    13 CGFCMAVFKWIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFY--HLFLTLFMWSYWRT 75

  Fly    72 CMLVDTSIRKELLKPPLDAAQLARWHS----------------------------CQDCQTLVPP 108
            .|.....|..:...|..:.::|.|..|                            |:.|:.:.|.
  Fly    76 IMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPD 140

  Fly   109 RSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAA---IMESIYLW----- 165
            |:.||.||:.||||.||||.:...|:..:||:||..:|.|.::..|..|   :.:.:..|     
  Fly   141 RAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEFWKVGAY 205

  Fly   166 ---------HLHLDIYWRWSTLFTIFAPVVSLMLSPSWES-----FYLVIYDLTLLGFAISSLLL 216
                     .|:.....|:..||..|   :::|.:.|..|     .|||:.:.|.|.        
  Fly   206 DNNGYSAQGQLNASGMGRFHILFLFF---IAIMFAISLVSLFGYHIYLVLVNRTTLE-------- 259

  Fly   217 VFHWSIFKSGSVTRERGTRKYDRGLRGNLEMVLGKRMHLTWLSPFLRS 264
            .|...||:.|...:    ..|:.|...|...|.|..... |..|...|
  Fly   260 SFRAPIFRVGGPDK----NGYNLGRYANFCEVFGDDWQY-WFLPVFSS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 43/154 (28%)
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 38/132 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467482
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.