DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and spe-10

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001021339.1 Gene:spe-10 / 3565514 WormBaseID:WBGene00004964 Length:351 Species:Caenorhabditis elegans


Alignment Length:199 Identity:50/199 - (25%)
Similarity:81/199 - (40%) Gaps:42/199 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 QLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAA 156
            |:.|...|.:|..:.|.|:.||..|..|.:|.||||.:...|:.|.||:||..|::|        
 Worm   149 QVGRLKYCYECGHIKPDRARHCSSCGKCCIKYDHHCPWINMCVTHVNYKYFLLYIIY-------- 205

  Fly   157 AIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWES------FYLVIYDL-TLLGFAISSL 214
                :.:|      :||   .|.|.....|...::..|..      |||..:.: .:.|:.....
 Worm   206 ----TSFL------VYW---YLLTSLEGAVRYFINQQWTDELGKFLFYLFSFIVGGVFGYYPLGE 257

  Fly   215 LLVFHWSIFKSGSVTRER---------GTRKYDRGLRGNLEMVLGKRMHLTWLSPFLRSDLPHDG 270
            |::||:.:......|.|:         ....|:.|...|.:.|.|..:   ||.|...|  ..||
 Worm   258 LIIFHYQLISLNETTVEQTKPALLRFDNAADYNMGKYNNFQSVFGWGL---WLCPIDSS--TQDG 317

  Fly   271 MNWE 274
            ::::
 Worm   318 LHFD 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 36/139 (26%)
spe-10NP_001021339.1 zf-DHHC 151..277 CDD:279823 38/146 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.