DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and ZDHHC21

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001341047.1 Gene:ZDHHC21 / 340481 HGNCID:20750 Length:265 Species:Homo sapiens


Alignment Length:259 Identity:55/259 - (21%)
Similarity:105/259 - (40%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CFLLVAVFVPVTYIFHVTIVMPELFA--------IGGIWYTLLWLASLFLIFNITSNMLACMLVD 76
            |.:.:.|||   ::::: :::|::..        |.||...:.:..|:|.:.    .::...:.|
Human    15 CCMGLIVFV---WLYNI-VLIPKIVLFPHYEEGHIPGILIIIFYGISIFCLV----ALVRASITD 71

  Fly    77 TSIRKELLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRY 141
            .....|  .|.:...:...|..|..|..:.|.||.||..|..||.:.||||.:...|:|..|: :
Human    72 PGRLPE--NPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNH-W 133

  Fly   142 FFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYLVI----- 201
            .|..|.:........|:|.|...::..|.:..|...|| :|...:::|...::....:::     
Human   134 LFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLF-VFRHELAIMRLAAFMGITMLVGITGL 197

  Fly   202 YDLTLLGFAISSLLLVFHWSIFKSGS----VTRERGTRKYDRGLRGNLEMVLGKRMHLTWLSPF 261
            :...|:|....:.      ||.|..:    ::|.|      :..:.....|.|.|..:.|..||
Human   198 FYTQLIGIITDTT------SIEKMSNCCEDISRPR------KPWQQTFSEVFGTRWKILWFIPF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 34/141 (24%)
ZDHHC21NP_001341047.1 DHHC 92..217 CDD:396215 33/132 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.