DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and CG17075

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:173 Identity:49/173 - (28%)
Similarity:82/173 - (47%) Gaps:31/173 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FLLVAVFVPVTYIFHVTIVMPELFA-IGGIWYTLLWLASLFLIFNITSNMLACML--VDTSIRK- 81
            :|::.:|...:|    .:::|...| |.|..|.|  :..|:|: :|.|::.|.:.  .|..:|: 
  Fly   118 WLVLLLFGVASY----WVLIPAFHARIQGPLYGL--ITGLYLV-HIASHLTALLTDPADKELRRV 175

  Fly    82 ---ELLKPPLDAAQLARWHS-------CQDCQTLVPP-RSWHCEVCNVCVLKRDHHCRFTCCCIG 135
               :.:.|..|.::    ||       |..|...... |:.||.|||.||.|.||||::...|||
  Fly   176 HRNDRIVPEFDRSK----HSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIG 236

  Fly   136 HHNYRYFFYYLVYMIIGSL--AAAIMESIYLWHLH---LDIYW 173
            ..||..|...:|..::.:|  .||::..|..:::.   |..||
  Fly   237 SRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYW 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 29/81 (36%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.