DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and zdhhc6

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001191086.1 Gene:zdhhc6 / 324468 ZFINID:ZDB-GENE-030131-3189 Length:412 Species:Danio rerio


Alignment Length:213 Identity:56/213 - (26%)
Similarity:85/213 - (39%) Gaps:62/213 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIY 163
            |:.||....|||.||..||.||:|.||||.:...|.||.|:.||..:|:...:|.:.||:   |:
Zfish   101 CRLCQGYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHLNHAYFTSFLLLAPLGCIHAAL---IF 162

  Fly   164 LWHLHLDIYWR----WSTLFT-------IFAPVVSLMLSPSWESFYLVIYDLTL--LGFAISSLL 215
            :..::..:|.|    ||::..       |..|::         .|.:..:..||  ||.|:.:.:
Zfish   163 IMTMYTQLYDRISFGWSSVKIDMSAARHIHHPIM---------PFSIAAFAATLFALGLALGTTI 218

  Fly   216 LVFHWSIFKSGSVTRERGTRK-----------------------YDRGLR-GNLEMVLGKRMHLT 256
            .|......:...:.|.|.:.:                       ||.|.| .|.:.|      .|
Zfish   219 AVGMLFFIQMKVILRNRTSIEAWIEEKAKDRIQYYQTGEDFIFPYDLGSRWENFKQV------FT 277

  Fly   257 WLSPFLRSDLP-HDGMNW 273
            |      |..| .||:.|
Zfish   278 W------SGAPMGDGIEW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 42/145 (29%)
zdhhc6NP_001191086.1 DHHC 95..241 CDD:396215 43/151 (28%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 409..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.