DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster


Alignment Length:236 Identity:61/236 - (25%)
Similarity:98/236 - (41%) Gaps:44/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FVPVTYIFHVTIVMPELF----------------AIGGIWYTLLWLASLFLIFNITSNMLACMLV 75
            ::|.|:.:.|.::...||                |..|: .|...||:..|...:...::.....
  Fly    10 YIPATFAWIVLLLTTFLFFFYPCQFYVKSHPWVLAYQGV-ITFFVLANFTLATFMDPGIIPKASP 73

  Fly    76 DTSIRKELLKPPLDAAQL------ARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCI 134
            |....:||..|....|::      .:|  |..|:...|||..||.|||.|:...||||.:...||
  Fly    74 DEDCEEELRAPLYKNAEINGITVKMKW--CVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCI 136

  Fly   135 GHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYL 199
            |..|||:||::||.:.|..|:...:..:|:..:..:|        ...||:|:::|........:
  Fly   137 GRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNI--------KDTAPIVAIILMGLVTILAI 193

  Fly   200 VIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDRG 240
            .|:.||           .||..:...|..|.|:.|.|:..|
  Fly   194 PIFGLT-----------GFHMVLVSRGRTTNEQVTGKFKGG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 40/132 (30%)
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 43/145 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.