DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc15

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001034190.1 Gene:Zdhhc15 / 317235 RGDID:1562075 Length:337 Species:Rattus norvegicus


Alignment Length:318 Identity:76/318 - (23%)
Similarity:117/318 - (36%) Gaps:80/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSWDRVKPRSISDFACFLLVAVFVPV------------TYIFH---VTIVMPE-----LFAIGGI 49
            |.|   |........|...|..:|||            .|:|.   ||::.|.     |.....|
  Rat     3 RGW---KMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAI 64

  Fly    50 WYTLLWL--ASLFLIFNITSNMLACMLVD---------TSIRKELLKPPLDAAQLARWHS----- 98
            :....|.  .|:|.:....:........|         ..::|::|   :|.|:....::     
  Rat    65 FVFFAWTYWKSIFTLPQQPNQKFHLSYTDKERYKNEERPEVQKQML---VDMAKKLPVYTRTGNG 126

  Fly    99 ----CQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIM 159
                |..|..:.|.|..||.||.:||||.||||.:...|||..||::|..:|.|.::..|  .|.
  Rat   127 AVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCL--YIA 189

  Fly   160 ESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVF--HWSI 222
            .:::.:.:.   |||...              ||..|.:.|::.|.:......||:::|  |..:
  Rat   190 TTVFSYFIK---YWRGEL--------------PSVRSKFHVLFLLFVACMFFVSLVILFGYHCWL 237

  Fly   223 FKSGSVTRE--------RGTRK--YDRGLRGNLEMVLGKRMHLTWLSPFLRSDLPHDG 270
            ......|.|        .|..|  ::.|...|::.|.|..... ||.|...|  |.||
  Rat   238 VSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDNKKF-WLIPIGSS--PGDG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 40/142 (28%)
Zdhhc15NP_001034190.1 zf-DHHC <125..308 CDD:303066 53/190 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..337 76/318 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.