DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001013141.1 Gene:Zdhhc4 / 304291 RGDID:1308389 Length:343 Species:Rattus norvegicus


Alignment Length:277 Identity:67/277 - (24%)
Similarity:107/277 - (38%) Gaps:46/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ACFLLVAVFVPVTYIFHVTIVMPEL-FAIGGIWYTLLWLASLFLIFNITSNMLACMLVDTSIRKE 82
            |..||:...|...|.:.|.....|| |::..:....:.|:...:.|.:|.:.....:..|::...
  Rat    70 ALHLLLQGLVYAEYTYEVFSYCRELEFSLPCLLLPYVLLSVNLVFFTLTCSTNPGTITKTNVLLL 134

  Fly    83 LLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLV 147
            |.....|.....:...|..|....|.||.||.||:.||.:.||||.:...|||..|..||..||:
  Rat   135 LQVYEFDEVMFPKNSRCSTCDLRKPARSKHCRVCDRCVHRFDHHCVWVNNCIGAWNTGYFLIYLL 199

  Fly   148 YMIIGSLAAAIMESIYLWHL----------HLDIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIY 202
            .:...:...||:.:.:|..|          :||...|:..:.|.|      ::...:.:|..:|:
  Rat   200 TLTASAATIAILSAAFLLRLVAVSNLYQETYLDDLGRFQAVDTGF------LIQHLFLAFPRIIF 258

  Fly   203 DLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDRGLRGNLEMVLGKRMHLTWLSPFLRSDLP 267
               ||||.|...||:..:..|........:.|.::.||             ...|.         
  Rat   259 ---LLGFVIVLSLLLAGYLCFALYLAATNQTTNEWYRG-------------DWAWC--------- 298

  Fly   268 HDGMNWEPIAAFSPKEE 284
               .:| |:.|:||..|
  Rat   299 ---QHW-PLVAWSPSAE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 42/142 (30%)
Zdhhc4NP_001013141.1 zf-DHHC 151..292 CDD:279823 43/149 (29%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.