DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006248672.1 Gene:Zdhhc8 / 303796 RGDID:1308875 Length:775 Species:Rattus norvegicus


Alignment Length:309 Identity:76/309 - (24%)
Similarity:118/309 - (38%) Gaps:93/309 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLAS------------LFL 61
            |:||            |.::||.....:.:....||.:    :|..||..            |||
  Rat     8 RLKP------------AKYIPVATAAALLVGSSTLFFV----FTCPWLTRAVSPAIPVYNGILFL 56

  Fly    62 IFNITSNMLACMLVDTSI---------RKELLKPPL----DAAQL---ARWHSCQDCQTLVPPRS 110
            .  :.:|......:|..:         :::..:.||    |...:   .:|  |..|....|||.
  Rat    57 F--VLANFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKW--CATCHFYRPPRC 117

  Fly   111 WHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYM---IIGSLAAAIMESIYLWHLHLDIY 172
            .||.||:.||...||||.:...|||..||||||.:|:.:   ::|.:|..:   :|:.: |.:..
  Rat   118 SHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGL---LYVLN-HSEGL 178

  Fly   173 WRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRER----- 232
            ....|..|:....|:.:       |::.:..||           .||..:...|..|.|:     
  Rat   179 GAAHTTITMAVMCVAGL-------FFIPVIGLT-----------GFHVVLVTRGRTTNEQVTGKF 225

  Fly   233 --GTRKYDRGLRGNLEMVL-----------GKRMHL--TWLSPFLRSDL 266
              |...:.||..||:|.||           ..||.|  :...||||.:|
  Rat   226 RGGVNPFTRGCYGNVEHVLCSPLAPRYVVEAPRMPLSVSLKPPFLRPEL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 39/135 (29%)
Zdhhc8XP_006248672.1 zf-DHHC 99..224 CDD:279823 41/148 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.