DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc3

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_038937239.1 Gene:Zdhhc3 / 301081 RGDID:1309041 Length:350 Species:Rattus norvegicus


Alignment Length:280 Identity:62/280 - (22%)
Similarity:110/280 - (39%) Gaps:73/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGGIWY----------TLLWLASLF-------------------LIFNITSNMLACMLVDTSIRK 81
            :|.:|:          .:.|...|:                   :|..|..|:||.:.:.:..|.
  Rat    33 VGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYAYSIINGIVFNLLAFLALASHCRA 97

  Fly    82 ELLKPP-----------LDAAQLARW---HSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCC 132
            .|..|.           :::.||...   :.|..|.::.|.|:.||.||..|:.|.||||.:...
  Rat    98 MLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNN 162

  Fly   133 CIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAP--VVSLMLSPSWE 195
            |:|.:|.:||..:.:|:.:.||.|.||...:..|...:.:.:.|:    |:|  .|.|::...:|
  Rat   163 CVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSS----FSPPTTVILLILLCFE 223

  Fly   196 SFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDR--------GLRGNLEMVLGKR 252
            :...:|:...:.|..:.|:             .|.|.|..:..|        |...:::...|..
  Rat   224 ALLFLIFTSVMFGTQVHSI-------------CTDETGIERLQRSKQPREQSGSWKSVQEAFGGE 275

  Fly   253 MHLTWLSPFLR---SDLPHD 269
            ..|.|.:||.|   .::|.|
  Rat   276 FSLNWFNPFTRPCQPEIPID 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 36/134 (27%)
Zdhhc3XP_038937239.1 DHHC 128..253 CDD:396215 38/141 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.