DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc1

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:215 Identity:52/215 - (24%)
Similarity:86/215 - (40%) Gaps:52/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WLASLFLI---FNITSNML---------ACM-------LV-----------DTSIRKELLKPPLD 89
            ||..||..   |.:...:|         |||       ||           |.::|.:....||.
  Rat    53 WLLYLFFAVIGFGVLVPLLPHHWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRDKSYSGPLP 117

  Fly    90 AAQLARWHS-------CQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLV 147
            ....:: |:       |..|...|..||.||..||.||...||||::...|:|..|||.|.:.:.
  Rat   118 IFNRSQ-HAHVIEDLHCNLCDVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLFLHSVA 181

  Fly   148 YMIIGSLAAAIMESIYLW------------HLHLDIYWRWSTLFTIFAPVVSL-MLSPSWESFYL 199
            ..::|.| ..::.:.|::            :.|.::....:.::.:|.|...: ..:|:..:...
  Rat   182 SALLGVL-LLVLVATYVFVEFFVNPMRLRTNQHFEVLKNHTDVWFVFLPAAPVETQAPAILALAA 245

  Fly   200 VIYDLTLLGFAISSLLLVFH 219
            ::..|.||..|:...||.||
  Rat   246 LLILLGLLSTALLGHLLCFH 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 36/134 (27%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 36/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.