DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and ZDHHC22

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001351101.1 Gene:ZDHHC22 / 283576 HGNCID:20106 Length:263 Species:Homo sapiens


Alignment Length:292 Identity:78/292 - (26%)
Similarity:116/292 - (39%) Gaps:75/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMILRSWDRVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPELF---AIGGIWYTLLWLASLFLI 62
            |:.||..:.|.|      |.||.:::   ||::..:.:.:|.:.   |...::...|...:|||.
Human     1 MLALRLLNVVAP------AYFLCISL---VTFVLQLFLFLPSMREDPAAARLFSPALLHGALFLF 56

  Fly    63 FNITSNMLA--CMLVDTSIRKELLKPPLDAAQLARWHSCQDC---QTLVPPRSWH-CEVCNVCVL 121
              :::|.|.  .:::..|        |.|..      :||..   :|..|..|.| |.||....|
Human    57 --LSANALGNYVLVIQNS--------PDDLG------ACQGASARKTPCPSPSTHFCRVCARVTL 105

  Fly   122 KRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTI-FA-P 184
            :.||||.||..|||..|.|.|..:.:|..:..|.:.:....|:           |.:.:| || |
Human   106 RHDHHCFFTGNCIGSRNMRNFVLFCLYTSLACLYSMVAGVAYI-----------SAVLSISFAHP 159

  Fly   185 VVSLMLSP-SWESFY------------LVIY-----DLTLLGFAISSLLLVFHWSI---FKSGSV 228
            :..|.|.| |...|:            |::|     .|...||....|||:.....   .:.|..
Human   160 LAFLTLLPTSISQFFSGAVLGSEMFVILMLYLWFAIGLACAGFCCHQLLLILRGQTRHQVRKGVA 224

  Fly   229 TRERGTRKYDRGLRGNLEMVLGKRMHLTWLSP 260
            .|.|..||       ||:.|.|||..|..|.|
Human   225 VRARPWRK-------NLQEVFGKRWLLGLLVP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 45/159 (28%)
ZDHHC22NP_001351101.1 DHHC 92..218 CDD:366691 39/136 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3153
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.