DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and ZDHHC24

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_997223.1 Gene:ZDHHC24 / 254359 HGNCID:27387 Length:284 Species:Homo sapiens


Alignment Length:255 Identity:78/255 - (30%)
Similarity:116/255 - (45%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNMLACMLVDTSIRKELLKPPLDAAQLAR-WHS 98
            :|.::.|....:|.:...|....:.|.:.|:..|:...:..|.|||..:|.    ...|.: |..
Human    35 YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVMLA----GRGLGQGWAY 95

  Fly    99 CQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVY---------MIIGSL 154
            |..||:.|||||.||..|.||:|:||||||....|:|..|||.|...|::         :::|..
Human    96 CYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGNYRPFLCLLLHAAGVLLHVSVLLGPA 160

  Fly   155 AAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFH 219
            .:|::.:....|:...:...|..|.|....:....|:        .:.|..:.|..:....|:||
Human   161 LSALLRAHTPLHMAALLLLPWLMLLTGRVSLAQFALA--------FVTDTCVAGALLCGAGLLFH 217

  Fly   220 WSIFKSGSVTRE--RGTRKYDRGLRGNLEMVLGKRMHLTWLSPFLRSDLPHDGMNWEPIA 277
            ..:...|..|.|  ||...||.|...||:..||.|..|.||.|||.|.||.||:.::..|
Human   218 GMLLLRGQTTWEWARGQHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 42/143 (29%)
ZDHHC24NP_997223.1 zf-DHHC 95..234 CDD:279823 43/146 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9123
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41720
Inparanoid 1 1.050 116 1.000 Inparanoid score I4820
Isobase 1 0.950 - 0 Normalized mean entropy S3153
OMA 1 1.010 - - QHG47998
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm40467
orthoMCL 1 0.900 - - OOG6_108577
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5808
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.720

Return to query results.
Submit another query.