DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and erf2

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_595766.1 Gene:erf2 / 2541058 PomBaseID:SPBC3H7.09 Length:350 Species:Schizosaccharomyces pombe


Alignment Length:296 Identity:72/296 - (24%)
Similarity:113/296 - (38%) Gaps:76/296 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SDFACFL--LVAVFVP--VTYIF-------HVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNM 69
            |.:..||  |.|:.:|  :.:||       ||:..:|..||         :|.:|.::     :|
pombe    82 SQYKAFLISLFALILPGVLFFIFSAFWLWHHVSPAVPITFA---------YLYALAVV-----SM 132

  Fly    70 LACMLVDTSI----------------------RKELLKPPLDAAQLARWHSCQDCQTLVPPRSWH 112
            ..|...|..|                      ||.|:......:.......|..|....|||:.|
pombe   133 FKCSTADPGILPRNAYSLTYNPAHPWSVIPEDRKVLVGSTRSDSVFVNTVYCHTCHLYRPPRASH 197

  Fly   113 CEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSL---AAAIMESIYLWHLHLDIYWR 174
            |.:|:.||...||||.:...|||..||||:|.:|:.:::.:|   ......||..:|...|    
pombe   198 CHLCDNCVEYLDHHCIWLNTCIGRRNYRYYFIFLLSVVLSALYLTGLGFYTSIGSFHESTD---- 258

  Fly   175 WSTLFTIFAPVVSLMLSPSWE--SFYLVIYDLTLLGFAISSLLLVFHWSIFKSG----SVTRERG 233
                 |.||    ..|...|.  ||:|.||.  .||..:..:|..:...:...|    ...|.:.
pombe   259 -----TNFA----AHLRRPWAGVSFFLGIYG--ALGAILPGILFCYQCYLISVGQNVHEYLRAKS 312

  Fly   234 TRKYD-----RGLRGNLEMVLGKRMHLTWLSPFLRS 264
            |...|     ..:..|..:||.:..:::::.|..:|
pombe   313 TETEDVHPFHDSIWLNFLVVLCRPKNVSYVRPTRKS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 43/141 (30%)
erf2NP_595766.1 COG5273 57..350 CDD:227598 72/296 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.