DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and ZDHHC20

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens


Alignment Length:303 Identity:73/303 - (24%)
Similarity:111/303 - (36%) Gaps:84/303 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CFLLVAVFVPVTYI-------FHVTIVMPELFAIGG---IWYTLLWLAS--LFLIFNITSNMLAC 72
            |...|..:|||.:|       ::..:|...:|.|.|   ...|:::|.:  ||.:..:.|..:..
Human     9 CCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTI 73

  Fly    73 MLVDTSIRKELLKPPLDAAQLARWHS-------------------------------CQDCQTLV 106
            .....|..||..   |..::..|:..                               |:.||.:.
Human    74 FTSPASPSKEFY---LSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIK 135

  Fly   107 PPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSL--AAAIME-SIYLWHLH 168
            |.|:.||..|:.|:||.||||.:...|:|..||::|..:|:|.::..|  ||.::| .|..|...
Human   136 PDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNE 200

  Fly   169 L-DIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSL-LLVFH-WSIFKSGSVTR 230
            | |...::..||..|   ||.|                   |.||.| |..:| |.:.|:.:...
Human   201 LTDTRAKFHVLFLFF---VSAM-------------------FFISVLSLFSYHCWLVGKNRTTIE 243

  Fly   231 ERGTRKYDRGLRG---------NLEMVLGKRMHLTWLSPFLRS 264
            ......:..|..|         |...|.|..... ||.|...|
Human   244 SFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKY-WLLPIFSS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 44/138 (32%)
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 71/296 (24%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.