DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:278 Identity:61/278 - (21%)
Similarity:106/278 - (38%) Gaps:88/278 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VPVTYI-------FHVTIVMPELFAIGGIW--YTLLWLAS------------LFLI--FNITSNM 69
            :|:::.       |:||:    |..:.|::  :...||..            ||::  |::.|..
Mouse    20 IPLSWFPSSVFAAFNVTL----LLFLSGLFFGFPCRWLVQNGEWAFPAITGPLFILTFFSLVSLN 80

  Fly    70 LACMLVDTSI--RKELLKPPL--------DAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRD 124
            .:    |..|  |....:.|:        ..|....|  |..|....|||::||..||:||...|
Mouse    81 FS----DPGILHRGSTKEDPMTVHVVRVNQRAFRLEW--CPKCLFHRPPRTYHCPWCNICVEDFD 139

  Fly   125 HHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHL-HLDIYWRWSTLFTIFAPVVSL 188
            |||::...||||.|:|.|...::.:.:.|.|..:....:|:.. ||.        |::...:..|
Mouse   140 HHCKWVNNCIGHRNFRLFMLLVLSLCLYSGALLVTCLTFLFRTRHLP--------FSLDKGMAIL 196

  Fly   189 MLSPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGT-----------RKYDRGLR 242
            :..|:             .||.|...||:    :.::.||:|...:           ..:|:|  
Mouse   197 VAVPA-------------AGFLIPLFLLL----LIQALSVSRAESSYESKCRYHPEYNPFDQG-- 242

  Fly   243 GNLEMVLGKRMHLTWLSP 260
                  ..|..:|...:|
Mouse   243 ------FAKNWYLAMFAP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 38/133 (29%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 26/73 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.