DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc22

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001074412.1 Gene:Zdhhc22 / 238331 MGIID:2685108 Length:263 Species:Mus musculus


Alignment Length:296 Identity:79/296 - (26%)
Similarity:114/296 - (38%) Gaps:83/296 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMILRSWDRVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPE---------LFAIGGIWYTLLWL 56
            |:.||..:.|.|      |.||.:::   ||::..:.:.:|.         ||:...:...|.  
Mouse     1 MLALRLLNVVAP------AYFLCISL---VTFVLQLFLFLPSMREDPTATPLFSPAVLHGALF-- 54

  Fly    57 ASLFLIFNITSNMLACMLVDTSIRKELLKPPLDAAQLARWHSCQDCQT---LVPPRSWH-CEVCN 117
              |||..|...|.:  :::..|        |.|..      :||...:   ..||.|.| |.||:
Mouse    55 --LFLSANALGNYV--LVIQNS--------PDDLG------TCQGTMSQRPQCPPPSTHFCRVCS 101

  Fly   118 VCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTI- 181
            ...|:.||||.||..|||..|.|.|..:.:|..:..|.:.:....|:           |.:.:| 
Mouse   102 RVTLRHDHHCFFTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAYI-----------SAVLSIS 155

  Fly   182 FA-PVVSLMLSP-SWESFY------------LVIY-----DLTLLGFAISSLLLVFHWSI---FK 224
            || |:..|.|.| |...|:            |::|     .|...||....|||:.....   .:
Mouse   156 FAHPLAFLTLLPTSISQFFSGAVLGSDMFVILMLYLWFAVGLACAGFCCHQLLLILRGQTRYQVR 220

  Fly   225 SGSVTRERGTRKYDRGLRGNLEMVLGKRMHLTWLSP 260
            .|...|.|..||       ||:.|.|||..|..|.|
Mouse   221 KGMAVRARPWRK-------NLQEVFGKRWLLGLLVP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 45/159 (28%)
Zdhhc22NP_001074412.1 DHHC 91..218 CDD:366691 40/137 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.