DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and Zdhhc5

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_659136.1 Gene:Zdhhc5 / 228136 MGIID:1923573 Length:715 Species:Mus musculus


Alignment Length:315 Identity:77/315 - (24%)
Similarity:120/315 - (38%) Gaps:85/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MILRSWDRVKPRS---ISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTL-----LWLAS 58
            |...|..|.||..   :|..|.||     |..|.:|..       |...|:...:     ::.|.
Mouse     1 MPAESGKRFKPSKYVPVSAAAIFL-----VGATTLFFA-------FTCPGLSLNVSPAVPIYNAI 53

  Fly    59 LFLIFNITSNMLACMLVDTSI---------RKELLKPPL------DAAQL-ARWHSCQDCQTLVP 107
            :||.  :.:|......:|..|         :::..:.||      ...|: .:|  |..|:...|
Mouse    54 MFLF--VLANFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKW--CATCRFYRP 114

  Fly   108 PRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYM---IIGSLAAAIMESIYLWHLHL 169
            ||..||.||:.||.:.||||.:...|||..||||||.:|:.:   |:|.....::..:|    |:
Mouse   115 PRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLY----HI 175

  Fly   170 DIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGT 234
            :......|..|:....|:.:       |::.:..||           .||..:...|..|.|:.|
Mouse   176 EELSGVRTAVTMAVMCVAGL-------FFIPVAGLT-----------GFHVVLVARGRTTNEQVT 222

  Fly   235 RKYDRGLR-------GNLEMVL------------GKRMHLTWLSPFLRSDLPHDG 270
            .|:..|:.       .|:..||            .|...:....||||.:: .||
Mouse   223 GKFRGGVNPFTNGCCNNVSRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEV-SDG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 39/135 (29%)
Zdhhc5NP_659136.1 zf-DHHC 99..224 CDD:279823 43/148 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.