DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and dhhc-1

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_510510.1 Gene:dhhc-1 / 181606 WormBaseID:WBGene00008606 Length:295 Species:Caenorhabditis elegans


Alignment Length:298 Identity:81/298 - (27%)
Similarity:131/298 - (43%) Gaps:67/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTLL---WL--ASLF--LIFNIT 66
            |:.|..|.|.....:..:.:|...:.|:..|:|       .||.::   |:  |:.|  |:||:.
 Worm    19 RMMPTQIQDIIATFIFLILLPCGILLHLLYVLP-------TWYPVMGEAWVIRATCFGVLVFNLY 76

  Fly    67 SNMLACMLVDT------SIRKELLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDH 125
            ||.:  .::.|      |....::||        .:..|..|.::.|.|:.||.||:||:|:|||
 Worm    77 SNWV--YMIKTGPNGHHSALPNVIKP--------GYKHCHSCHSMSPLRAHHCPVCDVCILRRDH 131

  Fly   126 HCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWR----WSTLFTIFAPVV 186
            ||.|...|:||.|.|||...::.:.|.:|...    .|.|.| |:|...    :..::.:..|.:
 Worm   132 HCSFGAVCVGHFNQRYFVAAVINLFIMTLPLV----SYSWSL-LNIKMTNEIGFGNIWQVVIPHL 191

  Fly   187 SLMLSPSWESFYLVIYDLTLLGFAISSLLLVFHW--SIFKSGSVTRE-----RGTRK-------- 236
                  :|.:.|:.||..      :..||.||.:  |:|....:|.:     :|..:        
 Worm   192 ------AWIAGYISIYQF------LHVLLFVFTFTVSLFTFYLLTAQVFCIYQGQTRIEFLMDVH 244

  Fly   237 -YDRGLRGNLEMVLGKRMHLTWLSPFLRSDLPHDGMNW 273
             |..||..||...||.|.....:|.|:.|.||.||:.:
 Worm   245 AYQLGLLENLHQSLGSRWPFIAISCFIPSPLPTDGLGF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 43/143 (30%)
dhhc-1NP_510510.1 zf-DHHC 98..240 CDD:279823 46/166 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41720
Inparanoid 1 1.050 99 1.000 Inparanoid score I3587
Isobase 1 0.950 - 0 Normalized mean entropy S3153
OMA 1 1.010 - - QHG47998
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm14450
orthoMCL 1 0.900 - - OOG6_108577
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.