DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and zdhhc12a

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_002663098.1 Gene:zdhhc12a / 100332332 ZFINID:ZDB-GENE-081104-40 Length:270 Species:Danio rerio


Alignment Length:222 Identity:53/222 - (23%)
Similarity:85/222 - (38%) Gaps:51/222 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YTLLWLASLFLIFNITSNMLACMLVDTSIR------KELLKPPLDAAQLA-RWHSCQDCQTLVPP 108
            ::.:.|.|:.|.|.::......:|.|:...      .|.|:..:...|.: :...|..|..|.|.
Zfish    49 FSSVLLLSVLLYFTVSLMDPGFVLSDSQTETASGDGDEELEAMIPQEQNSIKQRRCGYCFLLQPM 113

  Fly   109 RSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYW 173
            |:.||:.|..||.:.||||.:...|:|..|:|:|..||          .:..:...|.|..    
Zfish   114 RARHCKWCKRCVRRFDHHCPWIDNCVGELNHRWFLLYL----------CVQFTAVCWGLQS---- 164

  Fly   174 RWSTLFTIFAPVVSLMLSPSWES------FYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRER 232
            .||          ..:.:|||:.      |.||.:.:|.:...:..|||..|..:......|.|.
Zfish   165 AWS----------GFISAPSWQQWFTQNVFLLVAFAVTAVFSVVLLLLLCIHAYLASVNCTTWEF 219

  Fly   233 GTR--------------KYDRGLRGNL 245
            .:|              .:|||:..||
Zfish   220 MSRHRILYLKHVDSEENPFDRGVFCNL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 37/138 (27%)
zdhhc12aXP_002663098.1 DHHC 104..221 CDD:396215 38/140 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.