DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and slc66a1l

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001123690.1 Gene:slc66a1l / 100170445 XenbaseID:XB-GENE-5794175 Length:303 Species:Xenopus tropicalis


Alignment Length:58 Identity:16/58 - (27%)
Similarity:26/58 - (44%) Gaps:11/58 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNMLACMLVD 76
            ||||..|  :|..|:.|....:.:..::|   :.|.||...|      :|.:.|.|.:
 Frog    53 ACFLFAA--LPQLYVAHTNGRVDQALSLG---FLLCWLGGDF------TNFIGCYLTN 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823
slc66a1lNP_001123690.1 PQ-loop 44..103 CDD:282099 16/58 (28%)
PQ-loop 185..238 CDD:282099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.