powered by:
Protein Alignment CG4676 and slc66a1l
DIOPT Version :9
Sequence 1: | NP_610853.1 |
Gene: | CG4676 / 36465 |
FlyBaseID: | FBgn0033815 |
Length: | 284 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001123690.1 |
Gene: | slc66a1l / 100170445 |
XenbaseID: | XB-GENE-5794175 |
Length: | 303 |
Species: | Xenopus tropicalis |
Alignment Length: | 58 |
Identity: | 16/58 - (27%) |
Similarity: | 26/58 - (44%) |
Gaps: | 11/58 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 ACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNMLACMLVD 76
||||..| :|..|:.|....:.:..::| :.|.||...| :|.:.|.|.:
Frog 53 ACFLFAA--LPQLYVAHTNGRVDQALSLG---FLLCWLGGDF------TNFIGCYLTN 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.