DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and zdhhc20b

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_005162815.2 Gene:zdhhc20b / 100001188 ZFINID:ZDB-GENE-091117-30 Length:409 Species:Danio rerio


Alignment Length:277 Identity:73/277 - (26%)
Similarity:112/277 - (40%) Gaps:65/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IFHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNMLACMLVDTS------------IRKELLK 85
            :||::.||    .:...|.|         ||...:|......:..|            .::|:||
Zfish    86 VFHLSFVM----FVWSYWKT---------IFTKPANPSKEFCLPKSEKEQYEKEQRPETQQEILK 137

  Fly    86 P-----PL---DAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYF 142
            .     ||   ..|...|:  |..||.:.|.|..||..|::||||.||||.:...|:|..||::|
Zfish   138 KVATSLPLYTRTGAGAIRY--CDRCQVIKPDRCHHCSACDMCVLKMDHHCPWVNNCVGFSNYKFF 200

  Fly   143 FYYLVYMIIGSL--AAAIME-SIYLWHL----------HLDI---YWRWSTLFTIFAPVVSLMLS 191
            ..:|.|.::..|  ||:::: .|..|.|          ..|:   :.::..||..|   |:.|..
Zfish   201 ILFLTYSLVYCLFIAASVLQYFIKFWTLCRRKSAENCPKSDLPESHAKFHVLFLFF---VAAMFC 262

  Fly   192 PSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDRGLRGNLEMVLGKRMHLT 256
            .|..|  |..|.|.|:| ...|.:..|...:|::|.     ....:..|...|:..|.|..... 
Zfish   263 ISILS--LFTYHLWLVG-KNRSTIEAFRAPVFRNGP-----DKNGFSLGFSKNIAQVFGDEKKY- 318

  Fly   257 WLSPFLRSDLPHDGMNW 273
            ||.|...|.  .||:::
Zfish   319 WLLPVFTSQ--GDGLSF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 46/148 (31%)
zdhhc20bXP_005162815.2 zf-DHHC 44..342 CDD:327686 73/277 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.