DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fsd and Tmem183a

DIOPT Version :9

Sequence 1:NP_610851.2 Gene:fsd / 36463 FlyBaseID:FBgn0033813 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001013893.1 Gene:Tmem183a / 289034 RGDID:1309892 Length:376 Species:Rattus norvegicus


Alignment Length:272 Identity:72/272 - (26%)
Similarity:105/272 - (38%) Gaps:65/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 DIWFHISMHIDPEDVQTFALICKQTSRLVASRAFWRNLYRRHCTGATSGWNLNLPAELQLESIRN 128
            |||..::.:|.|||:..|:||||....:..:.|||..|||||.|     .:.:||..|:.||:. 
  Rat   136 DIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYT-----LDASLPLRLRPESME- 194

  Fly   129 CKTRALKSLVIAALFHCHRPLKVRLELGYNLDWMLQRIFVSCFQT--HYQCLWIMCYKF-WNRQS 190
             |.|.|::.||.:|:|.:.|...|:...       ..|..|...|  :.:||...|.|. .|||.
  Rat   195 -KLRCLRACVIRSLYHMYEPFAARISKN-------PAIPESTPSTLKNSKCLLFWCRKIVGNRQE 251

  Fly   191 HEQDETETHTGEVVNDWE----------SLADDDATKLAP------TFCNPHEGVVLLVVICRH- 238
            ..              ||          .|......:|.|      ...||.:...||.|...: 
  Rat   252 PM--------------WEFNFKFKKQSPRLKSKCMERLQPPIQYQDVHTNPDQDCCLLQVTTLNF 302

  Fly   239 -FVPTSNHLAYGPQQQRYRLRATRELLCTDMRAKNLELDFAEDGCR-------NVSVTVKHDRIE 295
             |:|    :..|.....:.:..:     ||||...:.|.|.:...|       ...|.|..|.:.
  Rat   303 IFIP----IVMGMIFTLFTINVS-----TDMRHHRVRLVFQDSPVRGGQHLRSEQGVQVVLDPVH 358

  Fly   296 KYKVLPWWHPDF 307
            ..::..||||.:
  Rat   359 SVRLFDWWHPQY 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fsdNP_610851.2 None
Tmem183aNP_001013893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..127
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353267
Domainoid 1 1.000 70 1.000 Domainoid score I9302
eggNOG 1 0.900 - - E1_28JRD
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5218
OMA 1 1.010 - - QHG50071
OrthoDB 1 1.010 - - D1290599at2759
OrthoFinder 1 1.000 - - FOG0007498
OrthoInspector 1 1.000 - - oto96494
orthoMCL 1 0.900 - - OOG6_109915
Panther 1 1.100 - - LDO PTHR20988
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5628
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.