Sequence 1: | NP_610850.1 | Gene: | Pex13 / 36462 | FlyBaseID: | FBgn0033812 | Length: | 440 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_009359.1 | Gene: | CDC24 / 851190 | SGDID: | S000000039 | Length: | 854 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 268 | Identity: | 47/268 - (17%) |
---|---|---|---|
Similarity: | 86/268 - (32%) | Gaps: | 94/268 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 146 QRFIY----------------MAESSSRPAFQSIESLVSAIGNIASML----------------- 177
Fly 178 --------------------DSTFFALTSS-------FRAILGVATNFVRLRSVFAQFWTTFAIF 215
Fly 216 RGLNWMYRKILYWLRLSNLDPSSAAFKKAFAEALNENNGQARGAPNVPRKGNSPWPVLAFISFIF 280
Fly 281 TAPYLIMKLLGTVTNTAQEEARNPAKWTAPIQTQAVYEFVARSPSELSLRAGQMLHVAPRDIQQT 345
Fly 346 LNLLNTGW 353 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pex13 | NP_610850.1 | Peroxin-13_N | 140..290 | CDD:282008 | 33/203 (16%) |
SH3_PEX13_eumet | 312..373 | CDD:212798 | 11/42 (26%) | ||
CDC24 | NP_009359.1 | CDC24 | 156..242 | CDD:399412 | |
RhoGEF | 282..453 | CDD:214619 | 11/48 (23%) | ||
PH_Scd1 | 455..667 | CDD:270066 | 36/217 (17%) | ||
PB1 | 779..853 | CDD:214770 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1291 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |