DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and CDC24

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_009359.1 Gene:CDC24 / 851190 SGDID:S000000039 Length:854 Species:Saccharomyces cerevisiae


Alignment Length:268 Identity:47/268 - (17%)
Similarity:86/268 - (32%) Gaps:94/268 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 QRFIY----------------MAESSSRPAFQSIESLVSAIGNIASML----------------- 177
            |.|:|                :||||.....:.:|:.:....|||..:                 
Yeast   404 QSFLYKPVQRLCRYPLLVKELLAESSDDNNTKELEAALDISKNIARSINENQRRTENHQVVKKLY 468

  Fly   178 --------------------DSTFFALTSS-------FRAILGVATNFVRLRSVFAQFWTTFAIF 215
                                |..|.:.|:|       |...|     |.::..:|::..|     
Yeast   469 GRVVNWKGYRISKFGELLYFDKVFISTTNSSSEPEREFEVYL-----FEKIIILFSEVVT----- 523

  Fly   216 RGLNWMYRKILYWLRLSNLDPSSAAFKKAFAEALNENNGQARGAPNVPRKGNSPWPVLAFISFIF 280
                   :|....|.|.....:||:..   |..:.:|||....:.: .|..||     :..:.|.
Yeast   524 -------KKSASSLILKKKSSTSASIS---ASNITDNNGSPHHSYH-KRHSNS-----SSSNNIH 572

  Fly   281 TAPYLIMKLLGTVTNTAQEEARNPAKWTAPIQTQAVYEFVARSPSELSLRAGQMLHVAPRDIQQT 345
            .:......::.:.||::...:.|.:       :.::::..|..| :|.||...|:....:.|.|.
Yeast   573 LSSSSAAAIIHSSTNSSDNNSNNSS-------SSSLFKLSANEP-KLDLRGRIMIMNLNQIIPQN 629

  Fly   346 LNLLNTGW 353
            ...||..|
Yeast   630 NRSLNITW 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 33/203 (16%)
SH3_PEX13_eumet 312..373 CDD:212798 11/42 (26%)
CDC24NP_009359.1 CDC24 156..242 CDD:399412
RhoGEF 282..453 CDD:214619 11/48 (23%)
PH_Scd1 455..667 CDD:270066 36/217 (17%)
PB1 779..853 CDD:214770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.