DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and PEX13

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_187412.1 Gene:PEX13 / 819945 AraportID:AT3G07560 Length:304 Species:Arabidopsis thaliana


Alignment Length:223 Identity:69/223 - (30%)
Similarity:86/223 - (38%) Gaps:62/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PLLPPS--SSIGVGVSSGGGYPPEAVLRTPYGNVRALPGPAQPP-----------PLPQSPFQQT 67
            |..|||  |:.|...:||...|.|.|           |.|...|           |:|..|::| 
plant    25 PFRPPSNTSTAGSVEASGTANPGEVV-----------PPPVNRPNTAANMNSLSRPVPARPWEQ- 77

  Fly    68 QQY-----GGFG------SGYGGNNYG--LGGYGGFNSGAFGYGGLGGFGSGLGSG--FGSGYGY 117
            |.|     ||:|      ||||...||  |||||....|.. |||...:..|.|.|  :||...|
plant    78 QNYGSTMGGGYGSNLGMTSGYGSGTYGSALGGYGSSYGGGM-YGGSSMYRGGYGGGGLYGSSGMY 141

  Fly   118 GGGYGGGYGGGFGG-------------GYNRFGAMGENDAEQRFIYMAESSSRPAF-----QSIE 164
            |||..|||||..||             |....|..|..|....|   .:..|.|.|     :.::
plant   142 GGGAMGGYGGTMGGYGMGMGTGMGMGMGMGMGGPYGSQDPNDPF---NQPPSPPGFWISFLRVMQ 203

  Fly   165 SLVSAIGNIASMLDSTFFALTSSFRAIL 192
            ..|:..|.:|.::|....|......|:|
plant   204 GAVNFFGRVAMLIDQNTQAFHMFMSALL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 13/58 (22%)
SH3_PEX13_eumet 312..373 CDD:212798
PEX13NP_187412.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19332
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.