DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and VAV2

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_016870597.1 Gene:VAV2 / 7410 HGNCID:12658 Length:896 Species:Homo sapiens


Alignment Length:177 Identity:44/177 - (24%)
Similarity:64/177 - (36%) Gaps:60/177 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LRSVFAQFWTTFAIFRGLNWMYR-KILYWLRLSNLDPSS-AAFKKAFAEALNENNGQARGAPNVP 263
            |:..|.|..||      |.:.|: :.....|.|:..|:| |::..:|...  :....|...|:.|
Human   770 LKESFKQLDTT------LKYPYKSRERSASRASSRSPASCASYNFSFLSP--QGLSFASQGPSAP 826

  Fly   264 RKGNSPWPVLAFISFIFTAPYLIMKLLGTVTNTAQEEARNPAKWTAPIQTQAVYEFVARSPSELS 328
            .     |.|       ||.     :::||..                    |.|.|.||...|||
Human   827 F-----WSV-------FTP-----RVIGTAV--------------------ARYNFAARDMRELS 854

  Fly   329 LRAGQMLHVAPR---DIQQTLNLLNTGWALATTNGQTSGIIPISYVK 372
            ||.|.::.:..|   |         .||....|||:. |..|.:||:
Human   855 LREGDVVRIYSRIGGD---------QGWWKGETNGRI-GWFPSTYVE 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 20/90 (22%)
SH3_PEX13_eumet 312..373 CDD:212798 22/64 (34%)
VAV2XP_016870597.1 CH_VAV2 2..120 CDD:409112
RhoGEF 202..375 CDD:214619
PH_Vav 389..534 CDD:269930
C1_VAV2 537..594 CDD:410418
SH3_VAV2_1 608..667 CDD:212913
SH2_Vav2 685..787 CDD:198269 7/22 (32%)
SH3_VAV2_2 837..894 CDD:212910 24/85 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.