DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pex13 and VAV1

DIOPT Version :9

Sequence 1:	NP_610850.1	Gene:	Pex13 / 36462	FlyBaseID:	FBgn0033812	Length:	440	Species:	Drosophila melanogaster
Sequence 2:	NP_005419.2	Gene:	VAV1 / 7409	HGNCID:	12657	Length:	845	Species:	Homo sapiens

Alignment Length:	93	Identity:	27/93 - (29%)
Similarity:	39/93 - (41%)	Gaps:	22/93 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   292 TVTNTAQEEARNPAKWTAPIQTQAV------------YEFVARSPSELSLRAGQMLHVAPRDIQQ 344
            ::..|.|...:.|.|.|  |...||            |:|.||..|||||:.|.::.:..:..||
Human   756 SLDTTLQFPFKEPEKRT--ISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQ 818

  Fly   345 TLNLLNTGWALATTNGQTSGIIPISYVK 372
                   ||......|:. |..|.:||:
Human   819 -------GWWRGEIYGRV-GWFPANYVE 838

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pex13	NP_610850.1	Peroxin-13_N	140..290	CDD:282008
Pex13	NP_610850.1	SH3_PEX13_eumet	312..373	CDD:212798	21/73 (29%)
VAV1	NP_005419.2	CH_VAV1	2..121	CDD:409111
		RhoGEF	195..371	CDD:238091
		PH_Vav	385..508	CDD:269930
		C1_VAV1	510..566	CDD:410417
		SH3_VAV1_1	596..658	CDD:212912
		SH2_Vav1	665..767	CDD:198268	2/10 (20%)
		SH3_VAV1_2	786..839	CDD:212909	19/61 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R1291
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.030