DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and PREX1

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_065871.3 Gene:PREX1 / 57580 HGNCID:32594 Length:1659 Species:Homo sapiens


Alignment Length:202 Identity:44/202 - (21%)
Similarity:70/202 - (34%) Gaps:53/202 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LTSSFRAILGVATNFV---------------RLRSVFAQFWTTFAIFRGLNWMYRKILYWLRLSN 233
            |.|:...||.|..:|:               .|.:||.:|...|.::......:.|.|..|...|
Human    99 LFSNIEDILEVHKDFLAALEYCLHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELN 163

  Fly   234 LDPSSAAFKKAFAEALNENNGQARGAPNVPRKGNSPWPVLAFISFIFTAPYLIMKL--------- 289
            ..|:..||      .|:......|...::|.:|.    :|:.|..|...|.|:.:|         
Human   164 KIPTVRAF------LLSCMLLGGRKTTDIPLEGY----LLSPIQRICKYPLLLKELAKRTPGKHP 218

  Fly   290 -----------LGTVTNTAQEEARNPAKWTAPIQTQAVYEFVARSPSELS------LRAGQMLHV 337
                       :.||.:...|..|...|..|..|.|:..|  ....|.|:      |..|.:|.:
Human   219 DHPAVQSALQAMKTVCSNIN
ETKRQMEKLEALEQLQSHIE--GWEGSNLTDICTQLLLQGTLLKI 281

  Fly   338 APRDIQQ 344
            :..:||:
Human   282 SAGNIQE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 28/140 (20%)
SH3_PEX13_eumet 312..373 CDD:212798 10/39 (26%)
PREX1NP_065871.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
RhoGEF 50..238 CDD:238091 30/148 (20%)
PH_Collybistin_ASEF 244..396 CDD:269931 12/47 (26%)
DEP 414..494 CDD:321936
DEP_2_P-Rex 506..598 CDD:239887
PDZ_signaling 627..703 CDD:238492
PDZ 721..773 CDD:238080
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..819
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.