DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pex13 and spata13

DIOPT Version :9

Sequence 1:	NP_610850.1	Gene:	Pex13 / 36462	FlyBaseID:	FBgn0033812	Length:	440	Species:	Drosophila melanogaster
Sequence 2:	XP_005162798.1	Gene:	spata13 / 568426	ZFINID:	ZDB-GENE-091116-25	Length:	1251	Species:	Danio rerio

Alignment Length:	114	Identity:	22/114 - (19%)
Similarity:	47/114 - (41%)	Gaps:	29/114 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 IQTQAVYEFVARSPSELSLRAGQMLHVAPRDIQQTLNLLNTGWALATTNGQTSGIIPISYVKSPQ 375
            :..:|:::.|.....||:.:||:::.|.  |:|:.    :..|.:.   |......|.|:|:
Zfish   747 VYAEALWDHVTMEEQELAFKAGEVIRVL--DVQEQ----DWWWGMV---GDREAWFPSSFVR--- 799

  Fly   376 QMRQEMQDQTKPAQPQPELMNLSAGAFASPPLEQQMNYDFNLAAQQQAP 424
             :|...:|.:            |....::|..|:.:..|    :.:|.|
Zfish   800 -VRVNQEDSS------------SESVESTPDTEEPIPSD----SHKQNP 831

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pex13	NP_610850.1	Peroxin-13_N	140..290	CDD:282008
Pex13	NP_610850.1	SH3_PEX13_eumet	312..373	CDD:212798	14/60 (23%)
spata13	XP_005162798.1	SH3	747..800	CDD:327375	14/65 (22%)
		RhoGEF	841..1020	CDD:214619
		PH_Collybistin_ASEF	1025..1163	CDD:269931
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R1291
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.030